PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10018209
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 309aa    MW: 33659.4 Da    PI: 8.9111
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10018209genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.18.2e-083075346
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                     +WT  E +l+ +a +++ ++   +W ++a+ ++ g+t  ++++ ++ 
      Lus10018209 30 KWTRGENKLFENALALYDKEtpdRWQKVAALIP-GKTVGDVINQYRE 75
                     8*****************99*************.**********986 PP

2Myb_DNA-binding48.22.6e-15139183347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + k++G+g+W+ I+r +  +Rt+ q+ s+ qky
      Lus10018209 139 PWTEEEHKLFLMGLKKYGKGDWRNISRNFVVTRTPTQVASHAQKY 183
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.6122681IPR017884SANT domain
SMARTSM007171.8E-72779IPR001005SANT/Myb domain
PfamPF002491.8E-62975IPR001005SANT/Myb domain
SuperFamilySSF466899.33E-112984IPR009057Homeodomain-like
CDDcd001676.63E-73076No hitNo description
PROSITE profilePS5129420.955132188IPR017930Myb domain
SuperFamilySSF466895.53E-17134187IPR009057Homeodomain-like
TIGRFAMsTIGR015578.9E-18135187IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.608.1E-13136183IPR009057Homeodomain-like
SMARTSM007172.7E-13136186IPR001005SANT/Myb domain
PfamPF002495.5E-13139183IPR001005SANT/Myb domain
CDDcd001671.38E-11139184No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MRWEMEVLSP ASYLSSTDSM LIEDGKMTTK WTRGENKLFE NALALYDKET PDRWQKVAAL  60
IPGKTVGDVI NQYRELEADV SSIEAGLIPI PGYCAASPFT LEWVSSNGFD GFKQSYGLSG  120
KRSSSGGRTP DQERKKGVPW TEEEHKLFLM GLKKYGKGDW RNISRNFVVT RTPTQVASHA  180
QKYFIRQLSG GKDKRRASIH DITTVNLNDT TRSSNSPDSS KQGSSPDQSM MGGAFQWNTH  240
HGRVGGAAAG AAMAFGSSTH GGNNMFICPP YGGFNSSSYN SGVKTEGGYD EGSMAFQMQS  300
AAQSYPHA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-1431931173RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX1744460.0JX174446.1 Linum usitatissimum clone LuBAC375M9, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012445667.11e-132PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H71e-119DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLI6YM670.0I6YM67_LINUS; Uncharacterized protein
STRINGPOPTR_0001s25590.11e-128(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46634162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.15e-98Homeodomain-like transcriptional regulator